CookSnap is coming soon — Join the waitlist →
Back to recipes

Creamy Chicken Liver Crostini

Seared chicken livers with butter, sage, and a splash of Marsala folded into a silky spread, served on crispy bread. Classic Italian simplicity that tastes like a trattoria.

Total time
18 min
Servings
2
Calories
380
Protein
18g
Creamy Chicken Liver Crostini
elegantrusticitalianchickencreamycrispyweeknightdate-night

Ingredients

  • ½ lb chicken livers
  • 1 whole (8 oz) baguette
  • 3 tbsp butter
  • 6 whole fresh sage leaves
  • ¼ cup Marsala wine
  • 1 whole shallot, minced

Instructions

  1. 1

    Slice baguette diagonally into 0.5-inch-thick pieces. Brush lightly with oil on both sides, arrange on a sheet pan, and toast at 400°F until golden, about 5 minutes.

  2. 2

    Pat chicken livers dry with paper towels. Season generously with salt and pepper.

  3. 3

    Heat 2 tbsp butter in a skillet over medium-high until foaming. Add livers in a single layer and sear without moving for 2 minutes until golden on bottom.

  4. 4

    Flip livers, add sage and minced shallot, and cook 90 seconds more until centers feel barely firm when pressed.

  5. 5

    Pour in Marsala, scraping up browned bits, and simmer 1 minute until liquid reduces slightly.

  6. 6

    Remove from heat. Mash livers coarsely with a fork, then stir in remaining 1 tbsp butter until creamy. Spread on warm toasted bread and serve immediately.

Tools you’ll need

  • sheet pan
  • 12-inch skillet
  • chef's knife
  • fork or wooden spoon
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.