CookSnap is coming soon — Join the waitlist →

Chicken and Leek Pie

A classic British pie with tender chicken and leeks in a creamy sauce, topped with buttery puff pastry. Ready in under an hour, it's comfort food at its finest.

Total time
50 min
Servings
4
Calories
480
Protein
28g
Chicken and Leek Pie
comfortwholesomebritishchickencreamyflakytenderweeknight

Ingredients

  • 3 tbsp butter
  • 4 medium leeks, white and light green parts, sliced into 1/2-inch rounds
  • 2 cups cooked chicken, shredded or cubed
  • 1 cup heavy cream
  • 1 puff pastry sheet, thawed
  • 1 pinch salt and black pepper to taste

Instructions

  1. 1

    Preheat oven to 400°F. Melt butter in a large skillet over medium heat.

  2. 2

    Add leeks and cook, stirring occasionally, until soft and translucent, 6-8 minutes.

  3. 3

    Stir in cooked chicken and cream. Simmer gently for 3 minutes until warmed through.

  4. 4

    Season with salt and pepper to taste. Pour filling into a 9-inch pie dish.

  5. 5

    Lay puff pastry over the filling, tucking edges down into the dish. Prick top with a fork.

  6. 6

    Bake for 20-25 minutes until pastry is golden brown and puffed.

  7. 7

    Let cool for 5 minutes before serving.

Tools you’ll need

  • large skillet
  • 9-inch pie dish
  • wooden spoon
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.