CookSnap is coming soon — Join the waitlist →
Back to recipes

British Chicken and Leek Pie

Tender chicken and leeks in a creamy, herb-flecked sauce, wrapped in buttery pastry. A classic British comfort dinner that feels special but comes together in under an hour.

Total time
50 min
Servings
4
Calories
520
Protein
38g
British Chicken and Leek Pie
comfortcozybritishchickencreamytenderflakyweeknight

Ingredients

  • 1.25 lb boneless, skinless chicken breasts
  • 4 medium leeks, white and light green parts only, sliced into 1/2-inch rounds
  • 3 tbsp butter
  • 2 tbsp all-purpose flour
  • 1 cup chicken broth
  • ½ cup heavy cream
  • 1 tsp fresh thyme or dried thyme
  • 1 sheet puff pastry sheet (thawed)
  • 1 pinch salt and black pepper to taste

Instructions

  1. 1

    Cut chicken breasts into 1.5-inch chunks. Season with salt and pepper.

  2. 2

    Rinse leeks thoroughly between layers to remove grit. Slice into 1/2-inch rounds.

  3. 3

    Heat 1 tbsp butter in a large skillet over medium-high until foaming. Sear chicken in two batches, ~3 minutes per side, until golden. Transfer to a plate.

  4. 4

    Add remaining 2 tbsp butter to the skillet. Add leeks and cook, stirring, until soft and lightly golden, ~5 minutes.

  5. 5

    Sprinkle flour over leeks. Stir for 60 seconds until flour is incorporated and the mixture smells toasted.

  6. 6

    Pour in broth and cream. Add thyme. Stir until smooth, breaking up any flour lumps.

  7. 7

    Return chicken to the skillet. Simmer uncovered for 10 minutes until sauce thickens. Taste and adjust seasoning.

  8. 8

    Preheat oven to 400°F. Transfer chicken-leek mixture to a 9-inch pie dish.

  9. 9

    Drape puff pastry over the filling. Press edges down to seal. Trim excess and prick surface with a fork.

  10. 10

    Bake for 18–22 minutes until pastry is puffed and deep golden brown. Cool 5 minutes before serving.

Tools you’ll need

  • large skillet
  • 9-inch pie dish
  • wooden spoon
  • knife and cutting board
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.