CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Chewy Oatmeal Raisin Cookies

Soft, chewy cookies loaded with oats and raisins, baked on a single sheet pan in under 25 minutes. Perfect for lunchboxes, snacking, or a quick homemade treat.

Total time
25 min
Servings
12
Calories
215
Protein
3g
Chewy Oatmeal Raisin Cookies
comfortsimpleamericanvegetarianvegetarianchewysoftDessert

Ingredients

  • ½ cup butter, softened
  • ¾ cup brown sugar
  • 1 whole egg
  • 1 cup all-purpose flour
  • 1.5 cups old-fashioned rolled oats
  • ¾ cup raisins

Instructions

  1. 1

    Set the oven to 350°F and wait until the indicator light or beep tells you it has finished heating, about 10 minutes.

  2. 2

    Place the softened butter and brown sugar in a large bowl and stir them together with a wooden spoon until smooth and well combined, about 1 minute.

  3. 3

    Crack the egg into the butter-sugar mixture and stir until you see no streaks of white, just one unified yellow color, about 30 seconds.

  4. 4

    Add the flour to the egg mixture and stir until you see no dry flour streaks remaining, about 1 minute.

  5. 5

    Add the oats to the bowl and stir until evenly distributed throughout the dough, about 1 minute.

  6. 6

    Add the raisins to the bowl and stir until they are scattered throughout the dough, about 30 seconds.

  7. 7

    Scoop the dough onto an ungreased baking sheet using a spoon or cookie scoop, spacing each blob about 2 inches apart, making 12 cookies total.

  8. 8

    Place the baking sheet on the middle oven rack and bake for 12 to 14 minutes, until the edges turn golden brown but the centers still look slightly soft.

  9. 9

    Remove the baking sheet from the oven and let the cookies cool on the sheet for 5 minutes—they will firm up as they cool.

  10. 10

    Slide a spatula under each cookie and transfer it to a plate or wire rack to cool completely, about 10 minutes.

Tools you’ll need

  • oven
  • large mixing bowl
  • wooden spoon
  • baking sheet (9x13 inch or larger)
  • spoon or cookie scoop
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.