Cheesy Ravioli with Marinara & Toast
Cheese ravioli boiled until tender, tossed with marinara and topped with parmesan. Toasted bread on the side for dipping. Done in 15 minutes.
- Total time
- 15 min
- Servings
- 2
- Calories
- 380
- Protein
- 16g
comfortquickitalianvegetariancheesetendercreamyweeknight
Ingredients
- 10 oz cheese ravioli
- 1.5 cups marinara sauce
- ¼ cup parmesan cheese, grated
Instructions
- 1
Bring a large pot of salted water to a boil.
- 2
Add ravioli and cook until they float and are tender, ~4 minutes.
- 3
Drain ravioli gently and return to the pot.
- 4
Pour marinara sauce over ravioli and stir gently to coat.
- 5
Divide into bowls and top generously with parmesan cheese.
- 6
Serve immediately with toasted bread alongside.
Tools you’ll need
- large pot
- wooden spoon
- colander
- bowls
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
