Cheesy Hilopites Skillet
Buttery square pasta tumbled with melting cheese and fresh herbs in one skillet — the Greek comfort dish that tastes fancier than it is. Ready in 15 minutes.
- Total time
- 15 min
- Servings
- 2
- Calories
- 520
- Protein
- 22g
comfortsimplegreekvegetariancheesetendermeltyweeknight
Ingredients
- 8 oz hilopites (Greek square pasta)
- 3 tbsp butter
- ¾ cup feta cheese, crumbled
- ½ cup Pecorino Romano, grated
- 2 tbsp fresh dill, chopped
- 1 whole lemon, zested and halved
Instructions
- 1
Boil hilopites in salted water until al dente, about 8 minutes.
- 2
Reserve 0.5 cup pasta water, then drain the pasta.
- 3
In a large skillet over medium heat, melt butter until foaming.
- 4
Add drained pasta, both cheeses, and 0.25 cup reserved pasta water. Toss until cheeses melt and coat the pasta, about 2 minutes.
- 5
Fold in fresh dill. Add more pasta water if needed to loosen the sauce.
- 6
Divide between bowls and squeeze fresh lemon over the top. Serve immediately.
Tools you’ll need
- large pot for boiling
- 12-inch skillet
- colander
- wooden spoon
- microplane or fine grater
- measuring cups and spoons
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
