CookSnap is coming soon — Join the waitlist →

Baked Gnocchi with Tomato & Mozzarella

Pillowy store-bought gnocchi baked in a hot skillet with crushed tomatoes, fresh mozzarella, and basil. Ready in under 20 minutes with zero fuss.

Total time
18 min
Servings
2
Calories
520
Protein
18g
Baked Gnocchi with Tomato & Mozzarella
comfortsimpleitalianvegetariancheesetendermeltyweeknight

Ingredients

  • 1 lb store-bought gnocchi
  • 1 can (14 oz) crushed tomatoes (canned)
  • 8 oz fresh mozzarella
  • ¼ cup, loosely packed fresh basil
  • 2 cloves, minced garlic
  • 3 tbsp olive oil

Instructions

  1. 1

    Heat olive oil in a 10-inch cast iron skillet over medium-high heat until shimmering, about 90 seconds.

  2. 2

    Add minced garlic and cook for 30 seconds until fragrant, stirring constantly.

  3. 3

    Pour in crushed tomatoes with juice. Stir in gnocchi, coating completely. Season with salt and pepper.

  4. 4

    Tear mozzarella into bite-sized pieces and scatter over the top. Transfer skillet to a 450°F oven.

  5. 5

    Bake for 8–10 minutes until cheese is bubbling and edges of sauce are caramelized.

  6. 6

    Remove from oven. Tear fresh basil over the top and drizzle with a little more olive oil. Serve hot.

Tools you’ll need

  • 10-inch cast iron skillet or oven-safe baking dish
  • wooden spoon
  • oven (preheated to 450°F)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.