CookSnap is coming soon — Join the waitlist →

Cheesy Garlic Pull-Apart Bread

Tear apart a loaf and stuff it with garlicky butter, melted Parmesan, and fresh rosemary, then bake until golden and crispy. One sheet pan, 15 minutes, pure comfort.

Total time
15 min
Servings
4
Calories
420
Protein
14g
Cheesy Garlic Pull-Apart Bread
comfortsimpleamericanvegetariancrispytendermeltyweeknight

Ingredients

  • 1 whole round loaf or boule bread (8 to 10 inches diameter)
  • 4 tbsp butter, softened
  • 4 cloves garlic cloves, minced
  • ¾ cup Parmesan cheese, grated
  • 2 sprigs fresh rosemary sprigs, leaves stripped and chopped
  • 1 pinch salt and black pepper

Instructions

  1. 1

    Preheat oven to 375°F. Mix softened butter with minced garlic, chopped rosemary, Parmesan, salt, and pepper in a small bowl until combined.

  2. 2

    Using a serrated knife, cut the bread in a crosshatch pattern without cutting all the way through the bottom—aim for 1-inch cubes that still hold together.

  3. 3

    Spread the garlic-butter mixture into every crevice and cut, working it between the bread pieces with a small spoon or butter knife.

  4. 4

    Place the loaf on a sheet pan lined with foil. Wrap the foil loosely around the sides to catch any dripping butter.

  5. 5

    Bake for 12 to 15 minutes until the bread is golden and the butter is sizzling, then unwrap the foil and broil for 1 minute to crisp the top.

  6. 6

    Serve hot. Pull apart pieces with your fingers and enjoy the melted Parmesan and garlicky butter inside.

Tools you’ll need

  • sheet pan
  • aluminum foil
  • small bowl
  • serrated knife
  • small spoon or butter knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.