CookSnap is coming soon — Join the waitlist →

15-Min Cheesy Chicken Enchilada Skillet

Rotisserie chicken, tortillas, and enchilada sauce layered straight in a skillet with melted cheese — no assembly, just dump and bake. Crispy edges, gooey center, dinner in 15 minutes.

Total time
15 min
Servings
4
Calories
485
Protein
32g
15-Min Cheesy Chicken Enchilada Skillet
comfortquicktex-mexchickenmeltycrispytenderweeknight

Ingredients

  • 2 cups rotisserie chicken, shredded
  • 2 cups red enchilada sauce
  • 8 count corn tortillas
  • 2 cups sharp cheddar cheese, shredded
  • ½ cup diced green chiles (canned)
  • ¼ cup Mexican crema or sour cream

Instructions

  1. 1

    Heat oven to 400°F. Spread 1/2 cup enchilada sauce in a 10-inch cast iron skillet or 2-qt baking dish.

  2. 2

    Toss shredded chicken with remaining sauce, green chiles, and crema in a bowl until combined.

  3. 3

    Layer 4 tortillas over sauce, overlapping. Spread half the chicken mixture over tortillas.

  4. 4

    Layer 4 more tortillas, then remaining chicken. Top with cheddar, covering edges.

  5. 5

    Bake 8–10 minutes until cheese bubbles and browns at edges. Edges should look crispy.

  6. 6

    Cool 2 minutes. Serve hot.

Tools you’ll need

  • 10-inch cast iron skillet or 2-qt baking dish
  • small mixing bowl
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.