Cheesy Breakfast Waffles
Crispy-edged waffles loaded with melted cheddar and cooked from a simple batter. Serve with roasted tomatoes and sour cream for a savory breakfast that feels special but takes under 20 minutes.
- Total time
- 18 min
- Servings
- 2
- Calories
- 520
- Protein
- 18g
comfortsimpleamericanvegetarianeggscrispyfluffyweeknight
Ingredients
- 1.5 cups all-purpose flour
- 1 cup cheddar cheese, shredded
- 2 large eggs
- 1 cup milk
- ½ tsp salt
- ¼ tsp black pepper
- 2 tbsp olive oil
Instructions
- 1
Whisk together flour, cheddar, salt, and pepper in a bowl.
- 2
In another bowl, whisk eggs and milk until smooth, then pour into dry ingredients.
- 3
Stir until just combined—a few lumps are fine—then drizzle in oil and fold gently.
- 4
Heat waffle iron and lightly oil it, then pour batter in and cook until golden and crispy, about 4 minutes.
- 5
Serve waffles warm alongside roasted cherry tomatoes and sour cream.
Tools you’ll need
- waffle iron
- two mixing bowls
- whisk
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
