Custrd is out on the App Store — Download it free →
Back to recipes

Cheese and Onion Pasty

A golden, flaky pasty filled with savory sautéed onions and melted cheese. Perfect for a quick weeknight dinner or lunch on the go.

Total time
40 min
Servings
4
Calories
450
Protein
12g
Cheese and Onion Pasty
comfortingBritishvegetariancheeseflakymeltedweeknight dinnerpasty

Ingredients

  • 1 sheet puff pastry sheet
  • 1 large onion
  • 150 g cheddar cheese
  • 1 tbsp butter
  • 1 large egg
  • ½ tsp salt
  • ¼ tsp black pepper

Instructions

  1. 1

    Preheat the oven to 200°C (400°F). Line a baking sheet with parchment paper.

  2. 2

    Melt the 1 tbsp butter in a skillet over medium heat. Add the 1 sliced onion and cook until soft and golden, about 8 minutes. Season with the 0.5 tsp salt and 0.25 tsp black pepper, then let cool slightly.

  3. 3

    Roll out the 1 puff pastry sheet on a lightly floured surface. Cut it into 4 equal squares.

  4. 4

    Divide the cooked onion and 150 g grated cheddar cheese among the centers of the pastry squares. Fold each square diagonally to form a triangle and press the edges with a fork to seal.

  5. 5

    Beat the 1 egg in a small bowl. Brush the tops of the pasties with the beaten egg.

  6. 6

    Place the pasties on the prepared baking sheet. Bake until golden brown and puffed, about 20-25 minutes. Let cool for 5 minutes before serving.

  7. 7

    Serve warm. Enjoy the flaky pastry and melted cheese filling!

Tools you’ll need

  • baking sheet
  • parchment paper
  • skillet
  • rolling pin
  • pastry brush
  • fork

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.