Custrd is out on the App Store — Download it free →
Back to recipes

Carapulcra

A quick and hearty Peruvian-style stew of chicken and potatoes simmered in a creamy, spiced sauce. This simplified version brings the rich flavors of the classic dish to your table in about 20 minutes.

Total time
25 min
Servings
4
Calories
520
Protein
32g
Carapulcra
comfortingPeruviangluten-freechickentendercreamyweeknightstew

Ingredients

  • 1.5 lb chicken thighs
  • 1.5 lb potatoes
  • 1 medium onion
  • 2 cloves garlic
  • 1 tsp ground cumin
  • 1 cup coconut milk

Instructions

  1. 1

    Cut the 1.5 lb chicken thighs and 1.5 lb potatoes into bite-sized pieces. Dice the 1 medium onion and mince the 2 garlic cloves.

  2. 2

    Heat 2 tbsp oil in a large skillet over medium-high. Add the chicken and cook until browned on all sides, about 5 minutes. Remove and set aside.

  3. 3

    In the same skillet, add the onion and garlic. Cook until soft, about 3 minutes. Stir in the 1 tsp cumin and cook for 1 minute until fragrant.

  4. 4

    Return the chicken to the skillet. Add the potatoes and 1 cup coconut milk. Bring to a simmer, then cover and cook until potatoes are tender and chicken is cooked through, about 15 minutes.

  5. 5

    Uncover and simmer for 2-3 minutes until the sauce thickens slightly. Season with salt and pepper to taste. Serve hot.

Tools you’ll need

  • Large skillet with lid
  • Cutting board
  • Knife
  • Measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.