Custrd is out on the App Store — Download it free →
Back to recipes

Bolivian Salteñas

A quick take on the classic Bolivian baked empanada, with a golden, browned crust and a savory filling. Perfect for a snack or light meal.

Total time
45 min
Servings
6
Calories
320
Protein
14g
Bolivian Salteñas
comfortingbolivianbeefcrispyflakyeverydayempanadasnack

Ingredients

  • 6 empanada dough discs
  • ½ lb ground beef
  • 1 medium onion
  • 1 medium potato
  • ½ cup beef broth
  • 1 large egg

Instructions

  1. 1

    Preheat oven to 400°F. Boil the 1 medium potato in salted water until fork-tender, about 15 minutes. Drain, cool, and dice into small cubes.

  2. 2

    In a skillet over medium heat, cook the 1 diced onion and 0.5 lb ground beef until beef is browned and onion is soft, about 8 minutes. Season with salt and pepper.

  3. 3

    Stir in the diced potato and 0.5 cup beef broth. Simmer until broth is mostly absorbed, about 5 minutes. Let cool slightly.

  4. 4

    Spoon about 2 tbsp filling onto each of the 6 empanada dough discs. Fold into half-moons, crimp edges with a fork, and brush tops with the 1 beaten egg.

  5. 5

    Bake on a lined sheet until golden brown and crisp, 20-25 minutes. Let rest 5 minutes before serving.

Tools you’ll need

  • baking sheet
  • skillet
  • pot
  • fork

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.