CookSnap is coming soon — Join the waitlist →

20-Min Caramelized Chicken & Shrimp Stew

Vietnamese-style mixed protein stew with chicken thighs and shrimp braised in caramel, fish sauce, and aromatics. A two-protein showstopper that feels fancy but comes together in one pot.

Total time
22 min
Servings
4
Calories
285
Protein
38g
20-Min Caramelized Chicken & Shrimp Stew
comfortsatisfyingvietnamesechickenshrimptenderjuicyweeknight

Ingredients

  • 1 lb boneless chicken thighs
  • ¾ lb large shrimp, peeled and deveined
  • 3 tbsp granulated sugar
  • 3 tbsp fish sauce
  • 1 medium yellow onion, halved lengthwise and sliced
  • 4 stalks scallions (white + light green parts), cut into 2-inch pieces
  • 2 tbsp ginger, sliced thin

Instructions

  1. 1

    Cut chicken thighs into 2-inch pieces. Pat dry with paper towels.

  2. 2

    Heat 1 tbsp oil in a heavy pot over medium-high. Add sugar and cook, swirling occasionally, until deep amber, ~3 minutes.

  3. 3

    Add chicken pieces. Stir to coat in caramel for 2 minutes without letting sugar burn.

  4. 4

    Pour in fish sauce (caramel will bubble). Add onion, ginger, and scallion whites. Bring to a boil, then lower to medium.

  5. 5

    Simmer 8 minutes until chicken is cooked through. Stir in shrimp and scallion greens.

  6. 6

    Cook 2 minutes more until shrimp are pink and cooked through. Taste and adjust salt if needed.

Tools you’ll need

  • Large heavy pot or Dutch oven
  • Knife and cutting board
  • Paper towels
  • Wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.