10-Min Canned Tuna Poke Bowl
Canned tuna mixed with soy sauce and served over warm rice with creamy avocado and crispy wonton chips. A weeknight poke bowl that tastes like takeout, ready in 5 minutes.
- Total time
- 10 min
- Servings
- 2
- Calories
- 385
- Protein
- 28g
quickfreshasianfishcrispycreamytenderweeknight
Ingredients
- 2 cups cooked white rice
- 2 cans (5 oz each) canned tuna in oil, drained
- 3 tbsp soy sauce
- 1 large avocado, sliced
Instructions
- 1
Divide warm rice between two bowls, packing it gently to form a base.
- 2
Toss drained tuna with soy sauce until well coated.
- 3
Spoon tuna mixture over the rice in each bowl.
- 4
Arrange avocado slices alongside the tuna.
- 5
Top with wonton chips and taro chips for crunch. Serve immediately.
Tools you’ll need
- two bowls
- spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
