20-Min Cajun Shrimp & Potato Skillet
Sheet-pan Cajun seafood dinner with shrimp, potatoes, and corn in a spiced butter sauce. Messy, bold, and ready in under 20 minutes.
- Total time
- 18 min
- Servings
- 2
- Calories
- 385
- Protein
- 32g
boldsatisfyingcajunshrimptendercrispyweeknightmain-dish
Ingredients
- 1 lb shrimp, peeled and deveined
- 1 lb baby potatoes, halved
- 1 cup corn kernels (fresh or frozen)
- 4 tbsp butter
- 2 tbsp Cajun seasoning
- 1 whole lemon
Instructions
- 1
Toss potatoes with 1 tbsp butter, 1 tbsp Cajun seasoning, and a pinch of salt on a sheet pan.
- 2
Roast potatoes at 425°F until edges brown, about 12 minutes.
- 3
Push potatoes to the side, scatter shrimp and corn on the pan, then dot with remaining 3 tbsp butter and 1 tbsp Cajun seasoning.
- 4
Return to oven for 4 minutes until shrimp edges turn pink and curl.
- 5
Squeeze lemon over the whole pan and toss gently until butter coats everything.
- 6
Serve hot, drizzling pan juices over the top.
Tools you’ll need
- sheet pan
- oven
- tongs
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
