Cajun Honey Butter Wings
Crispy pan-fried chicken wings tossed in a spicy-sweet cajun honey butter sauce. Ready in 15 minutes — no oven required.
- Total time
- 15 min
- Servings
- 2
- Calories
- 420
- Protein
- 32g
indulgentsatisfyingcajunchickencrispytenderweeknightgame-day
Ingredients
- 1.5 lbs chicken wings, separated into flats and drumettes
- 3 tbsp butter
- 2 tbsp honey
- 1.5 tsp cajun seasoning
- 1 tbsp hot sauce (like Frank's RedHot)
Instructions
- 1
Pat wings dry with paper towels. Season both sides generously with salt, pepper, and cajun seasoning.
- 2
Heat 2 tbsp oil in a large skillet over medium-high until it shimmers, about 90 seconds.
- 3
Add wings in a single layer. Cook 5–6 minutes per side without moving until edges are deep golden and crispy.
- 4
Add butter, honey, and hot sauce to the pan. Toss wings to coat until glossy, about 60 seconds.
- 5
Serve hot on a plate or platter. Drizzle any remaining sauce over the top.
Tools you’ll need
- 12-inch skillet or larger
- paper towels
- tongs or wooden spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
