CookSnap is coming soon — Join the waitlist →
Back to recipes

Café-Quality Cappuccino at Home

Espresso shots topped with velvety steamed milk and a thin layer of microfoam — the classic Italian ratio that tastes like your favorite coffee shop. Takes 5 minutes, no fancy equipment required.

Total time
5 min
Servings
1
Calories
95
Protein
7g
Café-Quality Cappuccino at Home
cozyelegantitalianvegetariancreamysilkyweeknightbrunch

Ingredients

  • 2 oz espresso
  • 8 oz whole milk, cold
  • ½ tsp sugar
  • ⅛ tsp salt

Instructions

  1. 1

    Pull two shots of espresso (2 oz total) into a warm 8–10 oz ceramic cup.

  2. 2

    Pour cold milk into a small pitcher. Add sugar and a pinch of salt.

  3. 3

    Steam or froth the milk using an espresso machine wand until it reaches 150–155°F and a thin layer of microfoam forms on top.

  4. 4

    Pour the steamed milk into the espresso, holding back the foam with a spoon. Top with a thin cap of microfoam.

  5. 5

    Serve immediately while the drink is still hot.

Tools you’ll need

  • espresso machine with steam wand
  • 8–10 oz ceramic cup
  • small milk pitcher (12 oz)
  • kitchen thermometer (optional but recommended)
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Italian recipes →