Café-Quality Cappuccino at Home
Espresso shots topped with velvety steamed milk and a thin layer of microfoam — the classic Italian ratio that tastes like your favorite coffee shop. Takes 5 minutes, no fancy equipment required.
- Total time
- 5 min
- Servings
- 1
- Calories
- 95
- Protein
- 7g

cozyelegantitalianvegetariancreamysilkyweeknightbrunch
Ingredients
- 2 oz espresso
- 8 oz whole milk, cold
- ½ tsp sugar
- ⅛ tsp salt
Instructions
- 1
Pull two shots of espresso (2 oz total) into a warm 8–10 oz ceramic cup.
- 2
Pour cold milk into a small pitcher. Add sugar and a pinch of salt.
- 3
Steam or froth the milk using an espresso machine wand until it reaches 150–155°F and a thin layer of microfoam forms on top.
- 4
Pour the steamed milk into the espresso, holding back the foam with a spoon. Top with a thin cap of microfoam.
- 5
Serve immediately while the drink is still hot.
Tools you’ll need
- espresso machine with steam wand
- 8–10 oz ceramic cup
- small milk pitcher (12 oz)
- kitchen thermometer (optional but recommended)
- spoon
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



