CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Bun Cha Gio with Crispy Spring Rolls

Vietnamese vermicelli bowl loaded with crispy fried spring rolls, lettuce, herbs, and tangy fish sauce dipping sauce. A weeknight dinner that tastes restaurant-fresh in under 20 minutes.

Total time
18 min
Servings
2
Calories
420
Protein
12g
20-Min Bun Cha Gio with Crispy Spring Rolls
casualsatisfyingvietnameseshrimpcrispytenderBreadweeknight

Ingredients

  • 3 oz rice vermicelli noodles (dried)
  • 6 pieces frozen spring rolls (pork or shrimp)
  • 3 tbsp fish sauce
  • 1 whole lime (juiced)
  • 2 cups butter lettuce or romaine, torn
  • ½ cup fresh herbs (cilantro, mint, basil), chopped

Instructions

  1. 1

    Boil salted water in a pot, add vermicelli noodles, and cook until tender, ~5 minutes. Drain, rinse with cold water, and set aside.

  2. 2

    Heat oil in a deep skillet or wok to 350°F (or until a wooden spoon handle sizzles when touched to surface). Fry spring rolls 2–3 minutes per side until golden and crispy.

  3. 3

    Transfer spring rolls to a paper towel-lined plate. Let cool 1 minute, then break each into halves.

  4. 4

    Whisk fish sauce with lime juice and 2 tbsp water. Taste and adjust—it should balance salty, sour, and umami.

  5. 5

    Divide noodles and lettuce between two bowls. Top with spring roll pieces and scattered herbs.

  6. 6

    Pour fish sauce dressing over the bowl. Serve immediately while spring rolls are still crispy.

Tools you’ll need

  • large pot
  • deep skillet or wok
  • thermometer (optional)
  • paper towels
  • small bowl (for dressing)
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.