CookSnap is coming soon — Join the waitlist →

Buffalo Cauliflower Tacos

Crispy roasted cauliflower tossed in spicy buffalo sauce, served in warm tortillas with cooling ranch and fresh toppings. Ready in 25 minutes.

Total time
25 min
Servings
2
Calories
380
Protein
12g
Buffalo Cauliflower Tacos
casualquickmexicanvegetariancrispytenderweeknighttaco

Ingredients

  • 1 head (about 4 cups) cauliflower florets
  • ¾ cup buffalo sauce
  • ½ cup flour
  • ½ cup water
  • 8 count corn tortillas
  • ½ cup ranch dressing
  • 2 cups lettuce or coleslaw mix
  • 1 whole lime

Instructions

  1. 1

    Preheat oven to 425°F. Pat cauliflower florets dry with paper towels.

  2. 2

    Mix flour and water in a bowl until smooth, no lumps visible.

  3. 3

    Dip cauliflower florets in batter, then spread on a rimmed sheet pan.

  4. 4

    Roast for 15 minutes until florets are golden and edges crisp.

  5. 5

    Remove from oven. Toss hot cauliflower with buffalo sauce until coated.

  6. 6

    Warm tortillas in a dry skillet over medium heat, 30 seconds per side.

  7. 7

    Drizzle ranch on each tortilla. Add lettuce, then buffalo cauliflower.

  8. 8

    Squeeze fresh lime juice over the top. Serve immediately.

Tools you’ll need

  • rimmed sheet pan
  • oven
  • medium mixing bowl
  • 12-inch skillet
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.