Breaded Veal Cutlet With Onions
A classic breaded veal cutlet, pan-fried until golden and crispy, topped with sweet caramelized onions and served with crusty bread and fresh microgreens.
- Total time
- 30 min
- Servings
- 4
- Calories
- 550
- Protein
- 35g
comfortingheartyGermanAustrianvealcrispytenderweeknight dinner
Ingredients
- 4 pieces veal cutlets
- ½ cup all-purpose flour
- 2 large eggs
- 1 cup breadcrumbs
- 2 medium onions
- 2 tablespoons butter
- ¼ cup vegetable oil
- 1 teaspoon salt
- ½ teaspoon black pepper
- 4 slices bread
Instructions
- 1
Pound veal cutlets to 1/4-inch thickness and season with salt and pepper.
- 2
Dredge each cutlet in flour, dip in beaten eggs, then coat with breadcrumbs.
- 3
Heat oil in a large skillet over medium-high heat and fry cutlets until golden brown, about 3 minutes per side.
- 4
In a separate pan, melt butter and sauté sliced onions until caramelized, about 10 minutes.
- 5
Serve cutlets topped with onions, alongside bread and microgreens.
Tools you’ll need
- meat mallet
- large skillet
- shallow dishes for breading
- spatula
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
