Custrd is out on the App Store — Download it free →
Back to recipes

Brazilian Street Pastries

Crispy, golden pastries with a savory cheese filling, just like from a Brazilian street cart. Quick to make and perfect for a snack or light meal.

Total time
20 min
Servings
4
Calories
450
Protein
12g
Brazilian Street Pastries
comfortingfestivebrazilianvegetariancheesecrispyflakystreet food

Ingredients

  • 2 cups all-purpose flour
  • ¾ cup water
  • 3 tbsp oil
  • 1 tsp salt
  • 1 cup shredded mozzarella cheese
  • 2 cups oil for frying

Instructions

  1. 1

    In a bowl, mix 2 cups flour, 1 tsp salt, 3 tbsp oil, and 0.75 cup water until a dough forms. Knead for 2 minutes until smooth, then let rest for 5 minutes.

  2. 2

    Divide dough into 4 balls. Roll each ball into a thin 8-inch circle on a floured surface, about 1/8-inch thick.

  3. 3

    Place 1/4 cup mozzarella on one half of each circle, leaving a 1/2-inch border. Fold the other half over and press edges with a fork to seal.

  4. 4

    Heat 2 cups oil in a deep skillet over medium-high until shimmering, about 350°F. Fry pastries one at a time for 2-3 minutes per side, until golden brown and puffed.

  5. 5

    Drain on paper towels and serve hot. Add oregano or chili flakes to the filling if you like.

Tools you’ll need

  • rolling pin
  • deep skillet
  • mixing bowl
  • fork

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.