CookSnap is coming soon — Join the waitlist →

Brazilian Chicken Empadão

A golden, flaky Brazilian chicken hand pie with a savory-creamy filling of shredded chicken, olives, and hard-boiled eggs. Crispy on the outside, tender and rich within.

Total time
50 min
Servings
4
Calories
520
Protein
22g
Brazilian Chicken Empadão
comfortcasualbrazilianchickeneggscrispyflakycreamy

Ingredients

  • 2.5 cups all-purpose flour
  • ¾ cup butter, cold and cubed
  • 2 whole egg yolks
  • ½ teaspoon salt
  • 2 cups shredded cooked chicken
  • 3 whole hard-boiled eggs, chopped
  • ¾ cup green olives, pitted and halved
  • ½ medium onion, finely diced
  • ½ cup heavy cream or sour cream

Instructions

  1. 1

    Pour 2.5 cups flour and 0.5 teaspoon salt into a large mixing bowl and stir them together with a fork until the salt is evenly scattered throughout.

  2. 2

    Add the 0.75 cup cold cubed butter to the flour, then use your fingertips to rub the butter and flour together until the mixture looks like coarse breadcrumbs with pea-sized lumps of butter still visible.

  3. 3

    In a small bowl, whisk the 2 egg yolks together with a fork until uniform, then pour them into the flour mixture.

  4. 4

    Stir the mixture with a fork until shaggy clumps form and no dry flour remains at the bottom of the bowl.

  5. 5

    Turn the dough onto an unfloured work surface and press it together with your hands for 20–30 seconds until it holds together as a ball, then flatten it into a disk 0.75 inches thick, wrap it in plastic wrap, and refrigerate for 15 minutes.

  6. 6

    Place a small skillet over medium heat and add 1 tablespoon of olive oil.

  7. 7

    When the oil is hot and shimmers, add the 0.5 diced onion and stir frequently until it turns soft and translucent, about 3–4 minutes.

  8. 8

    Pour the 2 cups shredded chicken, 3 chopped hard-boiled eggs, 0.75 cup halved olives, and 0.5 cup cream into the skillet and stir until all ingredients are evenly mixed and warm throughout, about 2 minutes.

  9. 9

    Remove the skillet from heat and let the filling cool to room temperature, about 5 minutes.

  10. 10

    Set the oven to 400°F and wait until the indicator light or beep tells you it has finished heating, about 10 minutes.

  11. 11

    Remove the dough disk from the refrigerator and place it on a lightly floured surface.

  12. 12

    Using a rolling pin, roll the dough into a circle 0.125 inches thick, working from the center outward and lifting and rotating the dough a quarter turn every few rolls to keep it even.

  13. 13

    Cut out 8 circles from the dough using a 4-inch round cutter (or an upturned drinking glass), then gather the scraps, re-roll, and cut 4 more circles for a total of 12 if possible, or set aside the scraps.

  14. 14

    Place 4 circles on a parchment-lined baking sheet, leaving space between each one.

  15. 15

    Spoon about 3 tablespoons of filling into the center of each circle on the baking sheet, leaving a 0.5-inch border uncovered around the edge.

  16. 16

    Top each filled circle with a second circle of dough, then press the edges together firmly with the tines of a fork to seal all the way around.

  17. 17

    In a small bowl, whisk together 1 egg yolk with 1 tablespoon water, then lightly brush this egg wash over the top of each pastry.

  18. 18

    Slide the baking sheet into the 400°F oven and bake until the pastry is deep golden brown, about 20–25 minutes.

  19. 19

    Remove the baking sheet from the oven and let the empadões cool on the sheet for 3–5 minutes before serving warm or at room temperature.

Tools you’ll need

  • large mixing bowl
  • fork
  • small bowl
  • plastic wrap
  • small skillet (8-inch)
  • wooden spoon
  • rolling pin
  • 4-inch round cutter or drinking glass
  • baking sheet
  • parchment paper
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.