CookSnap is coming soon — Join the waitlist →

Frittatina di Pasta

A crispy-edged Italian frittata loaded with leftover spaghetti, eggs, and a mix of ham and cheese. Ready in 25 minutes—pure comfort in a skillet.

Total time
25 min
Servings
4
Calories
345
Protein
22g
Frittatina di Pasta
comfortquickitalianeggshamcrispycreamyweeknight

Ingredients

  • 6 oz spaghetti, cooked
  • 6 large eggs
  • 3 oz ham, diced
  • ½ cup Pecorino Romano, grated
  • ¼ cup whole milk
  • 2 tbsp olive oil
  • 1 pinch salt and black pepper
  • 2 tbsp fresh parsley or chives, chopped

Instructions

  1. 1

    Whisk eggs with milk, half the cheese, salt, and pepper in a bowl until smooth.

  2. 2

    Heat olive oil in a 10-inch nonstick or cast iron skillet over medium-high until shimmering.

  3. 3

    Add cooked spaghetti and ham to the skillet, breaking the pasta into 2-inch pieces, and stir for 1 minute.

  4. 4

    Pour egg mixture evenly over the pasta, tilting the pan so it settles to the bottom.

  5. 5

    Cook without stirring for 6–7 minutes until edges brown and center still jiggles slightly.

  6. 6

    Sprinkle remaining cheese on top. Slide the skillet under the broiler for 2–3 minutes until the top is golden.

  7. 7

    Let cool for 2 minutes. Slide onto a cutting board, garnish with fresh herbs, and cut into wedges.

Tools you’ll need

  • 10-inch nonstick or cast iron skillet
  • mixing bowl
  • whisk
  • broiler or toaster oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.