CookSnap is coming soon — Join the waitlist →

Boston Cod Cakes

Crispy golden patties made with flaked cod, mashed potatoes, and pantry staples, pan-fried until the outside is crunchy and the inside stays tender. A classic New England comfort dish ready in under 30 minutes.

Total time
25 min
Servings
4
Calories
285
Protein
28g
Boston Cod Cakes
comfortcasualamericanfishcrispytenderweeknightpatty

Ingredients

  • 1 lb frozen cod fillets, thawed
  • 2 cups mashed potatoes (fresh or leftover)
  • 8 whole saltine crackers
  • 1 whole egg
  • ½ tsp each salt and pepper to taste
  • 3 tablespoons neutral oil for frying

Instructions

  1. 1

    Place the thawed cod fillets on a plate lined with paper towels, then press gently with another layer of paper towels to remove excess water so the cakes will be crispy when cooked.

  2. 2

    Use a fork to flake the dried cod into small pieces (about the size of peas) in a large mixing bowl, breaking apart any thick clumps.

  3. 3

    Crush the saltine crackers into fine crumbs between your fingers into a small bowl until they look like coarse sand, about 1 minute.

  4. 4

    Add the 2 cups of mashed potatoes, the crushed crackers, 1 egg, 0.5 tsp salt, and 0.5 tsp pepper to the bowl with the cod flakes.

  5. 5

    Stir with a wooden spoon until everything is evenly combined and holds together, about 1 minute; the mixture should feel like thick dough.

  6. 6

    Use your hands to form 8 equal patties about 2.5 inches wide and 0.75 inches thick, flattening each gently on a plate as you shape them.

  7. 7

    Pour 3 tablespoons of neutral oil into a 12-inch nonstick skillet and heat over medium-high heat until the oil shimmers and slides quickly across the pan, about 90 seconds.

  8. 8

    Slide 4 patties into the hot oil, spacing them so they do not touch, and leave them undisturbed to cook until the bottom is deep golden brown, about 3 minutes.

  9. 9

    Use a thin metal spatula to slide under each patty and flip it in one smooth motion, then cook the other side until it reaches the same deep golden brown, another 2 to 3 minutes.

  10. 10

    Transfer the finished patties to a clean plate lined with paper towels to drain any excess oil, then repeat steps 8–9 with the remaining 4 patties.

Tools you’ll need

  • paper towels
  • plate
  • fork
  • small bowl
  • large mixing bowl
  • wooden spoon
  • 12-inch nonstick skillet
  • thin metal spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.