Custrd is out on the App Store — Download it free →
Back to recipes

Borekas

Flaky, golden puff pastry parcels filled with a savory cheese mixture, baked until puffed and served with fresh lettuce and ketchup for dipping. A quick and satisfying snack or light meal.

Total time
25 min
Servings
2
Calories
550
Protein
15g
Borekas
comfortingmiddle easternvegetariancheeseflakycreamycasualpastry

Ingredients

  • 1 sheet puff pastry
  • 4 oz feta cheese
  • 1 large egg
  • 1 tbsp sesame seeds
  • 2 cups lettuce
  • 2 tbsp ketchup

Instructions

  1. 1

    Preheat oven to 400°F. Thaw puff pastry if frozen, then cut into 4 equal squares.

  2. 2

    In a bowl, mash 4 oz feta with 1 egg until well combined.

  3. 3

    Place a spoonful of filling in the center of each square, fold into a triangle, and press edges with a fork to seal.

  4. 4

    Brush tops with remaining egg (or a little milk) and sprinkle with 1 tbsp sesame seeds.

  5. 5

    Bake until golden and puffed, 15-18 minutes. Serve warm with lettuce and ketchup on the side.

  6. 6

    Serve warm with lettuce and ketchup on the side.

Tools you’ll need

  • baking sheet
  • parchment paper
  • mixing bowl
  • fork
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.