CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Bibimbap Bowl with Crispy Eggs

Warm rice topped with sautéed spinach, pickled vegetables, crispy-edged eggs, and a drizzle of gochujang sauce. Mix it all together and eat straight from the bowl — that's the whole point.

Total time
20 min
Servings
2
Calories
385
Protein
12g
20-Min Bibimbap Bowl with Crispy Eggs
comfortquickkoreanvegetarianeggscrispytenderweeknight

Ingredients

  • 2 cups cooked white or brown rice
  • 2 cups fresh spinach
  • 2 whole eggs
  • 2 tbsp gochujang (Korean red chili paste)
  • 1 tbsp sesame oil
  • ½ cup pickled vegetables (onions, jalapeños, or store-bought kimchi)
  • ½ cup shredded carrots or cucumber
  • 1 tbsp sesame seeds

Instructions

  1. 1

    Warm the rice in a small pot or microwave until steaming, 3–4 minutes.

  2. 2

    Heat 1 tbsp oil in a large skillet over medium-high. Sauté spinach until wilted, about 1 minute.

  3. 3

    Push spinach to the side. Crack eggs into the skillet and fry until whites set but yolks jiggle, 3–4 minutes.

  4. 4

    Divide rice between two bowls. Top each with spinach, a fried egg, pickled vegetables, and shredded carrots.

  5. 5

    Stir gochujang with 1 tbsp water and sesame oil until smooth. Drizzle over the bowl.

  6. 6

    Sprinkle sesame seeds on top. Mix everything together and eat immediately.

Tools you’ll need

  • large skillet (12-inch)
  • small pot or microwave
  • two bowls
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.