Banana Bread Overnight Oats
No-cook breakfast that tastes like dessert. Rolled oats, mashed banana, and warm spices soak overnight, then top with walnuts and a drizzle of honey.
- Total time
- 8 min
- Servings
- 2
- Calories
- 372
- Protein
- 11g
wholesomequickvegetarianyogurtcreamychewyweeknightmeal-prep
Ingredients
- 1 cup rolled oats
- ¾ cup plain yogurt
- 1 medium banana, mashed
- ½ cup milk (dairy or plant-based)
- 2 tbsp honey
- ½ tsp cinnamon
- ¼ cup walnuts, chopped
Instructions
- 1
Combine oats, yogurt, mashed banana, milk, 1 tbsp honey, and cinnamon in a mason jar or container.
- 2
Stir until completely combined. Cover and refrigerate at least 4 hours or overnight.
- 3
Divide between two bowls. Top each with half the walnuts and 0.5 tbsp honey.
- 4
Serve cold or microwave 60 seconds until warm. Stir before eating.
Tools you’ll need
- mason jar or airtight container
- spoon
- two bowls
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
