Custrd is out on the App Store — Download it free →
Back to recipes

Baked Fish

A simple, healthy weeknight dinner: white fish fillets baked with lemon, herbs, and olive oil until flaky and golden. Ready in under 30 minutes.

Total time
25 min
Servings
4
Calories
220
Protein
30g
Baked Fish
healthyeasymediterraneanpescatarianfishflakyweeknightmain

Ingredients

  • 4 filets white fish fillets
  • 1 whole lemon
  • ¼ cup chopped fresh parsley
  • 2 tablespoons olive oil
  • ½ teaspoon salt
  • ¼ teaspoon black pepper

Instructions

  1. 1

    Preheat oven to 400°F (200°C). Line a baking sheet with parchment paper.

  2. 2

    Pat the 4 fish fillets dry with paper towels. Place them on the prepared baking sheet.

  3. 3

    Drizzle the 2 tbsp olive oil over the fish, then sprinkle with 1/2 tsp salt and 1/4 tsp black pepper.

  4. 4

    Slice the 1 lemon into thin rounds. Lay the lemon slices over the fish fillets.

  5. 5

    Scatter the 1/4 cup chopped parsley over the top.

  6. 6

    Bake for 12-15 minutes, until the fish is opaque and flakes easily with a fork.

  7. 7

    Serve hot, with extra lemon wedges if desired.

Tools you’ll need

  • baking sheet
  • parchment paper
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.