CookSnap is coming soon — Join the waitlist →

20-Min Bacalao con Tomate

Flaky salt-cod fillets seared golden, then finished in a bright tomato sauce with garlic and a whisper of paprika. Spanish comfort in one skillet, ready in 20 minutes.

Total time
20 min
Servings
2
Calories
312
Protein
38g
20-Min Bacalao con Tomate
rusticsimplespanishfishflakytenderweeknightmain-dish

Ingredients

  • 1 lb salt cod (bacalao), skin-on fillets
  • 1 can (14 oz) canned crushed tomatoes
  • 3 cloves garlic cloves, minced
  • ½ tsp smoked paprika
  • 3 tbsp olive oil
  • ½ whole lemon

Instructions

  1. 1

    Pat cod fillets dry with paper towels. Season lightly with salt and black pepper on both sides.

  2. 2

    Heat olive oil in a large skillet over medium-high until shimmering, about 90 seconds.

  3. 3

    Sear cod skin-side down for 3 minutes without moving until skin is golden and crispy.

  4. 4

    Flip cod carefully. Add minced garlic to the pan around the fillets and cook 30 seconds until fragrant.

  5. 5

    Pour crushed tomatoes over cod, sprinkle paprika, and simmer gently for 6 minutes until sauce thickens.

  6. 6

    Squeeze lemon juice over the top and serve straight from the skillet.

Tools you’ll need

  • 12-inch skillet (cast iron or nonstick)
  • paper towels
  • wooden spoon
  • lemon juicer (optional)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.