CookSnap is coming soon — Join the waitlist →

Anzac Biscuits

Chewy-centered, crispy-edged oat biscuits sweetened with golden syrup and coconut. A classic Australian treat that bakes in under 30 minutes with just seven pantry staples.

Total time
35 min
Servings
12
Calories
195
Protein
3g
Anzac Biscuits
nostalgicsimpleaustralianvegetarianchewycrispyweekendpotluck

Ingredients

  • 1.5 cups rolled oats
  • 1 cup shredded coconut, unsweetened
  • 1 cup all-purpose flour
  • ½ cup butter, unsalted
  • ½ cup golden syrup
  • ½ teaspoon baking soda
  • ½ teaspoon salt

Instructions

  1. 1

    Set the oven to 350°F and wait for the indicator light to turn off, showing it has finished heating, about 10 minutes.

  2. 2

    Line two baking sheets with parchment paper, covering the entire flat surface.

  3. 3

    Pour 1.5 cups rolled oats, 1 cup unsweetened shredded coconut, and 1 cup all-purpose flour into a large mixing bowl and stir together until evenly combined.

  4. 4

    Place 0.5 cup butter and 0.5 cup golden syrup in a small saucepan over medium-low heat, stirring occasionally until the butter melts completely and the mixture looks uniform, about 3 minutes.

  5. 5

    Stir 0.5 teaspoon baking soda into the hot butter-syrup mixture (it will fizz); continue stirring for 10 seconds until the fizzing stops.

  6. 6

    Pour the warm butter-syrup mixture into the oat mixture and stir with a wooden spoon until everything is coated and clumpy, like wet sand, about 1 minute.

  7. 7

    Drop rounded teaspoons of dough onto the parchment-lined baking sheets, spacing them 2 inches apart (you should have 12 biscuits total), leaving room for them to spread.

  8. 8

    Slide the baking sheets into the preheated 350°F oven and bake until the biscuits are golden brown at the edges but still pale in the center, about 12 minutes.

  9. 9

    Remove the baking sheets from the oven and let the biscuits cool on the pan for 5 minutes without moving them (they will firm up as they cool).

  10. 10

    Lift each biscuit with a metal spatula and transfer to a wire cooling rack or clean plate to cool completely, about 10 minutes.

Tools you’ll need

  • oven
  • two baking sheets
  • parchment paper
  • large mixing bowl
  • wooden spoon
  • small saucepan
  • teaspoon measure
  • metal spatula
  • wire cooling rack

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.