CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Anago Don

Glazed conger eel over steamed rice with a sweet-savory tare sauce and fresh scallion garnish. A restaurant-quality Japanese classic ready in under 40 minutes.

Total time
35 min
Servings
2
Calories
520
Protein
28g
Anago Don
elegantsatisfyingjapanesefishtendercrispyweeknightdinner

Ingredients

  • 1 whole fish (about 1 lb) anago (conger eel), cleaned and gutted
  • 1 cup short-grain white rice
  • 1.25 cups water
  • 3 tbsp soy sauce
  • 2 tbsp mirin
  • 2 tbsp sake
  • ½ tsp sugar
  • 2 tbsp neutral oil
  • 2 stalks scallion, sliced thin

Instructions

  1. 1

    Rinse rice in a fine strainer under cold water until water runs clear, about 1 minute.

  2. 2

    Pat anago dry with paper towels. Cut crosswise into 2-inch-wide rings using kitchen shears or a sharp knife.

  3. 3

    In a small bowl, whisk together soy sauce, mirin, sake, and sugar until sugar dissolves.

  4. 4

    Combine rice and 1.25 cups water in a medium pot. Bring to a boil over high heat, then cover and reduce to low.

  5. 5

    Simmer covered for 18 minutes until water is absorbed and rice is tender. Remove from heat and let sit 5 minutes.

  6. 6

    Heat oil in a 10-inch skillet over medium-high until shimmering, about 60 seconds.

  7. 7

    Working in batches, pan-fry anago rings 2 minutes per side until the edges curl and flesh is opaque.

  8. 8

    Pour the soy-mirin glaze into the skillet. Shake the pan gently for 90 seconds until sauce coats the eel and thickens.

  9. 9

    Divide hot rice between two bowls. Top each with anago and sauce, then scatter scallion over the top.

  10. 10

    Serve immediately.

Tools you’ll need

  • fine-mesh strainer
  • paper towels
  • kitchen shears or sharp knife
  • small bowl
  • whisk
  • medium pot with lid
  • 10-inch skillet
  • tongs or chopsticks

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.