CookSnap is coming soon — Join the waitlist →
Back to recipes

Chicken Katsu Curry

Crispy panko-crusted chicken cutlets served over steamed rice with a rich, aromatic Japanese curry sauce. Restaurant-quality in 45 minutes with pantry staples.

Total time
45 min
Servings
4
Calories
745
Protein
42g
Chicken Katsu Curry
comfortsatisfyingjapanesechickencrispytendercreamyweeknight

Ingredients

  • 4 each (about 6 oz each) chicken breasts, boneless and skinless
  • 1 cup panko breadcrumbs
  • ½ cup all-purpose flour
  • 2 each eggs
  • 3.5 oz (half a standard box) Japanese curry roux (S&B Golden Curry or similar)
  • 1 each onion, medium
  • 1 each carrot, medium
  • 1 each potato, medium
  • 2 cups chicken stock or water
  • ½ cup vegetable oil for frying
  • 2 cups cooked short-grain white rice
  • 1 to taste salt and black pepper

Instructions

  1. 1

    Pound each chicken breast to 1/2-inch thickness using a meat mallet or pan bottom.

  2. 2

    Dice onion into 1/2-inch pieces. Cut carrot into 1/4-inch rounds. Cube potato into 1/2-inch pieces.

  3. 3

    Set up breading station: flour in one shallow bowl, beaten eggs in another, panko in a third.

  4. 4

    Coat each chicken breast in flour, shaking off excess, then dip in egg, then press into panko.

  5. 5

    Heat oil in a large skillet over medium-high until a breadcrumb sizzles immediately when dropped in.

  6. 6

    Fry chicken 4–5 minutes per side without moving, until golden brown and internal temp reaches 165°F.

  7. 7

    Transfer cooked chicken to a plate. Drain all but 1 tablespoon oil from the skillet.

  8. 8

    Add onion, carrot, and potato to the skillet. Sauté over medium heat for 5–6 minutes, stirring occasionally.

  9. 9

    Pour in stock. Bring to a simmer over medium heat, then reduce to low and cook 8 minutes until vegetables are fork-tender.

  10. 10

    Break curry roux into chunks and stir into the simmering liquid until fully dissolved, ~2 minutes.

  11. 11

    Return chicken to the pan, nestling it into the sauce. Simmer 3 minutes to warm through and meld flavors.

  12. 12

    Divide rice among bowls. Top each with one chicken breast and ladle curry sauce and vegetables over the top.

Tools you’ll need

  • meat mallet or small heavy pan
  • 3 shallow bowls for breading
  • 12-inch skillet or wider
  • meat thermometer
  • slotted spoon or tongs
  • cutting board and knife
  • large spoon for stirring

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.