CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Aloo Paratha

Crispy, golden Indian flatbread stuffed with spiced mashed potatoes. Cooked on a skillet until the exterior is flaky and the filling is steaming hot.

Total time
35 min
Servings
2
Calories
385
Protein
8g
Aloo Paratha
comfortwholesomeindianvegetarianvegetariancrispyfluffytender

Ingredients

  • 1.5 cups all-purpose flour
  • ½ cup water
  • 2 whole potatoes, medium
  • ½ teaspoon cumin seeds
  • 3 tablespoons ghee or butter
  • 1 dose salt and pepper to taste

Instructions

  1. 1

    Place the 2 potatoes in a pot and cover with cold water by 1 inch. Set the pot on the stove over high heat and bring the water to a rolling boil, about 8 minutes.

  2. 2

    Reduce heat to medium and simmer until a fork slides easily through the center of a potato, about 12 minutes more. Drain the potatoes in a colander.

  3. 3

    Let the potatoes cool for 2 minutes, then peel away the skin with your fingers or a vegetable peeler and discard it.

  4. 4

    Place the peeled potatoes in a bowl and mash with a fork until mostly smooth, leaving a few small lumps. Measure out salt and pepper into separate small bowls.

  5. 5

    In a medium bowl, pour the 1.5 cups flour and 0.5 cup water together. Mix with your hands or a wooden spoon until a soft, slightly sticky dough forms, about 1 minute.

  6. 6

    Knead the dough in the bowl by pushing it away from you with the heel of your hand, folding it back over itself, rotating the bowl slightly, and repeating for 3 minutes until smooth and elastic.

  7. 7

    Season the mashed potatoes with 0.5 teaspoon cumin seeds, a pinch of salt, and a pinch of pepper. Stir until the cumin is evenly distributed.

  8. 8

    Divide the dough into 4 equal pieces and roll each between your palms into a ball about the size of a golf ball.

  9. 9

    On a lightly floured work surface, use a rolling pin to flatten one dough ball into a thin round about 6 inches wide and 1/8 inch thick, rotating after each roll.

  10. 10

    Spoon 2 tablespoons of the spiced potato mixture into the center of the round. Fold the edges up and over the filling toward the center, pinching them closed, then gently flatten into a disk.

  11. 11

    Using the rolling pin, gently flatten the stuffed paratha into a round about 7 inches wide, 1/4 inch thick. Repeat steps 9–11 with the remaining dough balls and filling.

  12. 12

    Place a 12-inch nonstick skillet or griddle over medium-high heat and let it warm until a drop of water sizzles and evaporates in under 2 seconds, about 1 minute.

  13. 13

    Lay one paratha on the hot skillet. Cook until the bottom is spotted with light brown marks and the edges look set, about 2 minutes.

  14. 14

    Flip the paratha over using a metal spatula. Drizzle 0.5 tablespoon ghee or butter directly onto the surface.

  15. 15

    Cook the second side until it develops brown spots and looks crispy, about 2 minutes, then slide onto a plate.

  16. 16

    Repeat steps 13–15 with the remaining 3 parathas, using 0.5 tablespoon ghee or butter for each one.

Tools you’ll need

  • large pot
  • colander
  • fork
  • vegetable peeler or paring knife
  • medium mixing bowl
  • wooden spoon or hands for kneading
  • measuring cups
  • measuring spoons
  • small bowls (2)
  • work surface or cutting board
  • rolling pin
  • 12-inch nonstick skillet or griddle
  • metal spatula
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.