5-Minute Cumin Rice
Fragrant basmati rice tempered with toasted cumin seeds, ghee, and a pinch of salt. Ready in under 5 minutes with pre-cooked rice — the TikTok version of jeera rice that actually works on a weeknight.
- Total time
- 5 min
- Servings
- 2
- Calories
- 220
- Protein
- 4g
simplefreshindianvegetarianvegandairy-freefluffyweeknight
Ingredients
- 1 tbsp cumin seeds
- 1 tbsp ghee or neutral oil
- 2 cups cooked basmati rice
- ¼ tsp salt
- 0.1 tsp black pepper
Instructions
- 1
Heat ghee in a skillet over medium-high until shimmering, about 30 seconds.
- 2
Add cumin seeds and toast until fragrant and slightly darkened, 60–90 seconds.
- 3
Pour in cooked rice, breaking up any clumps with a spoon.
- 4
Toss gently for 1 minute until rice is warmed through and coated with ghee.
- 5
Season with salt and black pepper to taste.
- 6
Serve immediately while hot.
Tools you’ll need
- 10-inch skillet
- wooden spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
