CookSnap is coming soon — Join the waitlist →
Back to recipes

Crepes with Jam & Ricotta

Paper-thin crepes made in one skillet, filled with whipped ricotta and jam in under 5 minutes. The batter cooks in advance—store it in the fridge and make fresh crepes whenever hunger strikes.

Total time
25 min
Servings
2
Calories
380
Protein
12g
Crepes with Jam & Ricotta
elegantsimplefrenchvegetariancheesecreamytenderfluffy

Ingredients

  • ¾ cup all-purpose flour
  • 1 cup whole milk
  • 2 whole eggs
  • ¾ cup ricotta cheese
  • ½ cup jam (any flavor)
  • 2 tbsp powdered sugar

Instructions

  1. 1

    Whisk flour, milk, eggs, and a pinch of salt in a bowl until smooth. Let rest 5 minutes.

  2. 2

    Heat a 10-inch nonstick skillet over medium-high. Lightly butter it, then pour 3 tbsp batter in the center.

  3. 3

    Tilt and swirl the pan immediately so batter spreads thin and even. Cook 60 seconds until the bottom is pale golden.

  4. 4

    Flip the crepe. Cook the other side 20 seconds until set. Slide onto a plate. Repeat with remaining batter.

  5. 5

    Whisk ricotta with powdered sugar. Spread 2 tbsp on each crepe, add 1 tbsp jam, then fold in half.

  6. 6

    Serve warm or at room temperature. Dust with extra powdered sugar if you like.

Tools you’ll need

  • mixing bowl
  • whisk
  • 10-inch nonstick skillet
  • spatula
  • butter knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.