5-Min Pizza Toast
Sliced bread topped with pizza sauce and melted mozzarella — a crispy-edged, cheesy breakfast that tastes like pizza in under 5 minutes. Broil or toast until the cheese bubbles and browns.
- Total time
- 5 min
- Servings
- 2
- Calories
- 285
- Protein
- 12g
quicksimpleamericanvegetariancrispymeltyweeknightbreakfast
Ingredients
- 4 slices bread
- ½ cup pizza sauce
- 1 cup mozzarella cheese, shredded
Instructions
- 1
Arrange bread slices on a baking sheet and broil for 90 seconds until lightly toasted.
- 2
Spread 2 tbsp pizza sauce evenly on each slice, then top with a handful of mozzarella.
- 3
Broil for 2–3 minutes until cheese bubbles and edges brown slightly; watch it closely.
- 4
Serve hot straight from the broiler.
Tools you’ll need
- baking sheet
- broiler
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
