CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Shoyu Chicken

Sweet-salty Hawaiian-style chicken thighs glazed in soy, brown sugar, and ginger. Crispy-skinned and caramelized in one skillet, served over rice.

Total time
25 min
Servings
4
Calories
520
Protein
42g
Shoyu Chicken
comfortsatisfyinghawaiianchickencrispytenderjuicyweeknight

Ingredients

  • 8 pieces (about 3 lbs) chicken thighs, bone-in skin-on
  • ½ cup soy sauce
  • ¼ cup brown sugar
  • 1 tbsp fresh ginger, minced
  • 3 cloves garlic cloves, minced
  • ¼ cup water

Instructions

  1. 1

    Pat chicken thighs dry. Season with salt and pepper on both sides.

  2. 2

    Heat 2 tbsp oil in a large skillet over medium-high until shimmering. Working in batches, sear thighs skin-side down until golden brown, about 4 minutes per side. Transfer to a plate.

  3. 3

    Pour off all but 1 tbsp fat. Add ginger and garlic, stir constantly until fragrant, about 30 seconds.

  4. 4

    Whisk together soy sauce, brown sugar, and water. Pour into skillet and bring to a gentle simmer.

  5. 5

    Return chicken to skillet skin-side up. Simmer uncovered for 10 minutes, basting thighs with sauce every 2–3 minutes until glaze coats and thickens.

  6. 6

    Serve hot over steamed rice, spooning extra sauce over the top.

Tools you’ll need

  • large skillet (12-inch cast iron or stainless steel)
  • tongs
  • whisk
  • instant-read thermometer (optional)
  • serving spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.