15-Min Creamy Penne
Penne, marinara, and cream cheese come together in an Instant Pot for a silky, rich pasta that tastes like you simmered it for hours. Ready in under 5 minutes of pressure cooking.
- Total time
- 15 min
- Servings
- 4
- Calories
- 520
- Protein
- 18g
comfortitalianvegetariancreamytenderweeknightpastadinner
Ingredients
- 12 oz penne pasta
- 24 oz marinara sauce
- 6 oz cream cheese
Instructions
- 1
Add penne, marinara sauce, and 1 cup water to the Instant Pot.
- 2
Seal the lid and set to high pressure for 4 minutes.
- 3
Quick-release the pressure, then stir in the cream cheese until smooth.
- 4
Season with salt and pepper to taste, then serve hot.
Tools you’ll need
- Instant Pot (6-quart or larger)
- wooden spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
