CookSnap is coming soon — Join the waitlist →
Back to recipes

Creamy Cardamom Rice Pudding

Silky Indian rice pudding made in one pot with coconut milk, sweetened condensed milk, and warm cardamom spice. Creamy, fragrant, and ready in under 10 minutes.

Total time
10 min
Servings
4
Calories
385
Protein
7g
Creamy Cardamom Rice Pudding
comfortindulgentindianvegetariancreamysilkyweeknightcozy

Ingredients

  • 1.5 cups cooked basmati rice (or jasmine rice, day-old or cooled)
  • ¾ cup sweetened condensed milk
  • ¾ cup coconut milk (full-fat, canned)
  • ¼ cup cashews (halved or crushed)
  • ¼ cup raisins (or dried cranberries)
  • 4 whole cardamom pods (crushed, seeds only)
  • ⅛ tsp saffron strands
  • 1 tbsp ghee or butter (for toasting nuts)

Instructions

  1. 1

    Toast cashews in a small skillet over medium heat with ghee until fragrant and golden, ~2 minutes. Set aside.

  2. 2

    Crush cardamom pods gently with the side of a knife or mortar to release seeds. Discard husks.

  3. 3

    Pour condensed milk and coconut milk into a medium pot. Stir in cardamom seeds and saffron strands.

  4. 4

    Heat over medium, stirring occasionally, until steaming and fragrant—do not boil, ~3 minutes.

  5. 5

    Fold in cooked rice and raisins gently. Stir for 1 minute to combine and warm through.

  6. 6

    Spoon into bowls. Top with toasted cashews and a pinch of cardamom. Serve warm or chilled.

Tools you’ll need

  • medium pot
  • small skillet
  • wooden spoon
  • mortar and pestle or knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.