CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Creamy Fettuccine

Silky fettuccine coated in a butter-and-Parmesan sauce that comes together faster than takeout. One skillet, zero cream, pure richness.

Total time
12 min
Servings
2
Calories
582
Protein
22g
Creamy Fettuccine
comfortindulgentitalianvegetariancheesecreamysilkyweeknight

Ingredients

  • 8 oz fettuccine
  • 4 tbsp butter
  • 1 cup Parmesan cheese, finely grated
  • 2 clove garlic cloves, minced
  • ½ whole lemon
  • ¼ tsp black pepper

Instructions

  1. 1

    Boil fettuccine in salted water until al dente, about 9 minutes. Reserve 1 cup pasta water, then drain.

  2. 2

    Melt butter in the same pot over medium heat. Add garlic and cook 30 seconds until fragrant.

  3. 3

    Add drained pasta back to the pot, remove from heat, and toss with Parmesan until coated.

  4. 4

    Pour in 3/4 cup pasta water, stirring gently until sauce becomes creamy and silky.

  5. 5

    Squeeze lemon juice over the top, season with black pepper, and toss once more.

  6. 6

    Serve immediately, adding more pasta water if the sauce tightens as it cools.

Tools you’ll need

  • Large pot
  • Wooden spoon
  • Measuring cups
  • Measuring spoons
  • Microplane or box grater

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.