CookSnap is coming soon — Join the waitlist →
Back to recipes

Viral Butter Cheese Pasta

Creamy, luxurious pasta in under 15 minutes—just butter, cheese, pasta water, and Pecorino. The starchy pasta water emulsifies into a silky sauce that coats every strand.

Total time
15 min
Servings
2
Calories
520
Protein
18g
Viral Butter Cheese Pasta
comfortsimpleitalianvegetariancreamysilkyweeknightpasta

Ingredients

  • 8 oz short-cut pasta (spaghetti, linguine, or bucatini)
  • 4 tbsp butter
  • 1 cup Pecorino Romano cheese, finely grated
  • 1 tsp salt
  • ½ tsp black pepper

Instructions

  1. 1

    Bring a large pot of salted water to a boil. Add pasta and cook until al dente, stirring once halfway through.

  2. 2

    Reserve 1 cup pasta cooking water, then drain pasta in a colander.

  3. 3

    Return the empty pot to medium heat. Add butter and let it melt, swirling until foaming, about 1 minute.

  4. 4

    Add drained pasta to the pot with butter. Toss to coat, then add 0.75 cup pasta water.

  5. 5

    Remove from heat. Add Pecorino, salt, and pepper. Toss constantly until sauce clings to pasta, adding pasta water by the spoonful if it looks dry.

  6. 6

    Serve immediately in warm bowls. Finish with a crack of black pepper.

Tools you’ll need

  • large pot
  • colander
  • wooden spoon or tongs
  • measuring cup
  • box grater or microplane

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.