CookSnap is coming soon — Join the waitlist →
Back to recipes

Butter Pasta Alfredo

Creamy, silky fettuccine tossed in a garlic-butter sauce with Parmesan—no heavy cream needed. Real restaurant texture in under 15 minutes.

Total time
15 min
Servings
2
Calories
620
Protein
22g
Butter Pasta Alfredo
comfortelegantitalianvegetariancheesecreamysilkyweeknight

Ingredients

  • 8 oz fettuccine
  • 4 tbsp butter
  • 3 cloves garlic, minced
  • 1 cup Parmesan cheese, finely grated
  • ½ tsp black pepper
  • ½ whole lemon

Instructions

  1. 1

    Boil salted water in a large skillet or pot. Add fettuccine and cook until al dente, ~9 minutes. Reserve 1 cup pasta water before draining.

  2. 2

    Return the skillet to medium heat. Melt butter, then add minced garlic and cook 30 seconds until fragrant (don't let it brown).

  3. 3

    Add the drained pasta to the skillet. Drizzle in 0.5 cup pasta water and toss constantly for 1 minute until silky.

  4. 4

    Remove from heat. Add Parmesan and toss vigorously for 30 seconds. Add more pasta water if too thick; sauce should coat the noodles.

  5. 5

    Season with black pepper. Squeeze lemon juice over the top and toss once more.

  6. 6

    Serve immediately in warm bowls.

Tools you’ll need

  • 12-inch skillet or large pot
  • colander
  • wooden spoon
  • microplane or box grater
  • kitchen towel (optional, for drying pasta)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.