CookSnap is coming soon — Join the waitlist →

10-Min Chocolate Martabak

Crispy, buttery pan-fried pancake stuffed with melted chocolate and crushed peanuts. Ready in minutes with zero oven fuss — pure indulgent snack energy.

Total time
10 min
Servings
2
Calories
520
Protein
12g
10-Min Chocolate Martabak
indulgentquickindonesianvegetarianeggscrispyflakygooey

Ingredients

  • 1 cup all-purpose flour
  • 2 whole eggs
  • ¾ cup whole milk
  • ½ cup chocolate chips or chopped chocolate
  • ¼ cup roasted peanuts, crushed

Instructions

  1. 1

    Whisk flour, eggs, and milk until smooth batter forms with no lumps.

  2. 2

    Heat butter in a 10-inch skillet over medium-high until it foams, ~90 seconds.

  3. 3

    Pour half the batter into the skillet and swirl to coat the bottom evenly.

  4. 4

    Once the bottom is light golden and set, scatter chocolate chips and peanuts over half.

  5. 5

    Fold the plain half over the filled half and press gently until chocolate starts to melt.

  6. 6

    Flip once and cook until the second side is golden and crispy, ~90 seconds total.

Tools you’ll need

  • 10-inch nonstick skillet
  • whisk
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.