CookSnap is coming soon — Join the waitlist →
Back to recipes

10-Min Carrot Fudge Bars

Creamy, fudgy carrot halwa compressed into chewy bars — no oven, no waiting. Cardamom and ghee make it taste like the real thing in a fraction of the time.

Total time
12 min
Servings
4
Calories
420
Protein
6g
10-Min Carrot Fudge Bars
indulgentsimpleindianvegetarianvegetarianchewyfudgydense

Ingredients

  • 2 cups carrot, finely grated
  • ¾ cup ghee or clarified butter
  • ½ cup sweetened condensed milk
  • ½ cup chopped cashews or almonds
  • 3 tbsp milk powder (or instant vanilla pudding mix)
  • 4 whole green cardamom pods, crushed
  • 2 oz dark chocolate, chopped (optional layer)
  • 2 tbsp desiccated coconut (optional garnish)

Instructions

  1. 1

    Heat ghee in a wide skillet over medium. Add grated carrot and stir constantly until it darkens and smells nutty, 6–7 minutes.

  2. 2

    Stir in condensed milk, cashews, milk powder, and cardamom seeds. Cook, stirring, until the mixture thickens and pulls from the pan sides, 2–3 minutes.

  3. 3

    Pour mixture onto a parchment-lined 8-inch square pan. Press flat with a wet spatula until level.

  4. 4

    If using chocolate, scatter chopped pieces over the surface while the halwa is still warm. Let them soften, then spread evenly.

  5. 5

    Refrigerate until set, 20–30 minutes. Cut into 12–16 bars. Garnish with coconut if desired.

Tools you’ll need

  • wide skillet or heavy-bottomed pan
  • wooden spoon or silicone spatula
  • 8-inch square baking pan
  • parchment paper
  • knife for cutting

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Indian recipes →