Custrd is out on the App Store — Download it free →
Back to recipes

Zucchini Salad with Parmesan

A crisp, fresh salad of shaved zucchini tossed with lemon, olive oil, and salty parmesan. Ready in minutes, perfect for a light lunch or side.

Total time
15 min
Servings
2
Calories
220
Protein
10g
Zucchini Salad with Parmesan
freshlightitalianvegetariancheesecrisptenderweekday dinner

Ingredients

  • 2 medium zucchini
  • ½ cup (shaved) parmesan cheese
  • 1 medium lemon
  • 2 tablespoons olive oil
  • ½ teaspoon salt
  • ¼ teaspoon black pepper

Instructions

  1. 1

    Trim the ends off the 2 zucchinis and use a vegetable peeler to shave them into long, thin ribbons. Place the ribbons in a large bowl.

  2. 2

    Zest the lemon and squeeze 2 tablespoons of juice. In a small bowl, whisk together the lemon juice, 2 tablespoons olive oil, 0.5 teaspoon salt, and 0.25 teaspoon black pepper.

  3. 3

    Pour the dressing over the zucchini ribbons and toss gently with your hands to coat every ribbon evenly.

  4. 4

    Add the 0.5 cup shaved parmesan and toss once more. Let the salad sit for 5 minutes so the zucchini softens slightly, then serve immediately.

  5. 5

    Garnish with extra parmesan and a pinch of black pepper if desired.

Tools you’ll need

  • vegetable peeler
  • large bowl
  • small bowl
  • whisk
  • citrus juicer

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.