CookSnap is coming soon — Join the waitlist →
Back to recipes

15-Min Wok Char Kway Teow

Crispy, smoky stir-fried flat rice noodles with prawns, egg, and a punchy soy-garlic sauce. The wok char gives it that signature charred edge that tastes like restaurant.

Total time
15 min
Servings
2
Calories
520
Protein
28g
15-Min Wok Char Kway Teow
satisfyingcasualmalaysianshrimpcrispychewyweeknightstir-fry

Ingredients

  • 200 g fresh prawns (peeled and deveined)
  • 300 g fresh flat rice noodles (about 2 inches wide)
  • 2 whole eggs
  • 3 tbsp soy sauce
  • 3 cloves garlic (minced)
  • 50 g Chinese chives or scallions (cut into 1-inch pieces)

Instructions

  1. 1

    Heat a wok or 12-inch skillet over high heat for 30 seconds until smoking hot.

  2. 2

    Add 2 tbsp neutral oil. Swirl to coat, then add minced garlic and sauté 20 seconds until fragrant.

  3. 3

    Add prawns and cook 2 minutes until they turn pink, stirring constantly.

  4. 4

    Push everything to the side. Crack eggs into the empty space and scramble 30 seconds, then toss with prawns.

  5. 5

    Add rice noodles and soy sauce. Stir constantly for 2–3 minutes until the noodles are heated through and edges char.

  6. 6

    Toss in chives, stir for 10 seconds, then slide onto a plate and serve immediately.

Tools you’ll need

  • wok or 12-inch skillet
  • wooden spatula or wok turner
  • cutting board and knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Malaysian recipes →