Custrd is out on the App Store — Download it free →
Back to recipes

Whisky Beef Tenderloin with Crispy Fries

Sear beef tenderloin until golden, then finish in a buttery whisky-cream sauce. Serve with crispy oven fries for a Spanish-inspired weeknight dinner that feels fancy but takes 20 minutes.

Total time
20 min
Servings
2
Calories
720
Protein
48g
Whisky Beef Tenderloin with Crispy Fries
indulgentelegantspanishbeeftendercrispyweeknightdate-night

Ingredients

  • 2 pieces (6 oz each) beef tenderloin steaks (filet or solomillo)
  • 1 lb russet potatoes
  • ¼ cup whisky (or brandy)
  • ⅓ cup heavy cream
  • 2 tbsp butter
  • 2 cloves garlic cloves, minced

Instructions

  1. 1

    Cut potatoes into 1/4-inch fries, pat dry, toss with oil and salt, spread on a sheet pan, and bake at 425°F for 15 minutes.

  2. 2

    Pat beef steaks dry and season generously on both sides with salt and black pepper.

  3. 3

    Heat 1 tbsp oil in a heavy skillet over medium-high until shimmering, about 90 seconds.

  4. 4

    Sear steaks 90 seconds per side without moving. They should be golden brown and centers still medium-rare.

  5. 5

    Remove steaks to a plate. Add garlic to the pan and cook 30 seconds until fragrant, then pour in whisky and scrape up browned bits.

  6. 6

    Simmer whisky 1 minute to reduce slightly, then stir in cream and butter until melted and smooth.

  7. 7

    Return steaks to the pan, spoon sauce over them, and cook 30 seconds to warm through.

  8. 8

    Serve steaks with sauce and crispy fries on the side.

Tools you’ll need

  • sheet pan
  • heavy 12-inch skillet
  • knife and cutting board
  • paper towels
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.