CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Beef Scaloppine with Creamy Mushrooms & Roasted Veg

Thin, golden beef cutlets in a silky mushroom cream sauce, served with a sheet pan of roasted vegetables. Restaurant-worthy in under 25 minutes.

Total time
25 min
Servings
2
Calories
520
Protein
42g
Beef Scaloppine with Creamy Mushrooms & Roasted Veg
elegantsatisfyingitalianbeeftendercreamycrispyweeknight

Ingredients

  • ¾ lb beef sirloin cutlets (or thin-sliced sirloin)
  • 8 oz mushrooms, sliced
  • ½ cup heavy cream
  • ¼ cup dry white wine
  • 1.5 cups broccoli crowns, steamed
  • 2 cups mixed roasted vegetables (carrots, zucchini, corn, potatoes)
  • 1 tbsp fresh lemon juice

Instructions

  1. 1

    Pat beef cutlets dry, season both sides with salt and pepper.

  2. 2

    Heat 2 tbsp oil in a 12-inch skillet over medium-high until shimmering, ~90 seconds.

  3. 3

    Sear cutlets 90 seconds per side without moving. Remove to a plate.

  4. 4

    In the same skillet, sauté mushrooms 3 minutes until golden, stirring occasionally.

  5. 5

    Pour in wine, scrape the pan with a wooden spoon for 30 seconds, then stir in cream.

  6. 6

    Return cutlets to pan, simmer 2 minutes until sauce coats the back of a spoon.

  7. 7

    Squeeze lemon juice over top. Serve scaloppine alongside steamed broccoli and roasted vegetables.

Tools you’ll need

  • 12-inch stainless steel or cast iron skillet
  • wooden spoon
  • cutting board
  • chef's knife
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.