CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Warm Mushroom Hummus

Creamy Lebanese-style hummus topped with sautéed mushrooms, garlic, and warm olive oil. Ready in under 15 minutes—perfect for mezze platters or as a dip.

Total time
12 min
Servings
6
Calories
285
Protein
9g
Warm Mushroom Hummus
rusticelegantlebanesevegetarianveganchickpeascreamysmooth

Ingredients

  • 1.5 cans (15 oz each) canned chickpeas, drained and rinsed
  • 3 tbsp tahini (sesame paste)
  • 3 tbsp lemon juice
  • 2 cloves garlic, minced
  • 8 oz mushrooms (cremini or button), thinly sliced
  • ½ cup olive oil, divided

Instructions

  1. 1

    Add chickpeas, tahini, lemon juice, and 1 minced garlic clove to a food processor.

  2. 2

    Pulse until smooth. Add water 1 tbsp at a time until you reach a silky, thick consistency.

  3. 3

    Season with salt and pepper. Transfer to a shallow serving bowl.

  4. 4

    Heat 2 tbsp olive oil in a skillet over medium-high until shimmering, about 1 minute.

  5. 5

    Add sliced mushrooms and remaining minced garlic. Cook 5 minutes, stirring occasionally, until mushrooms are golden and tender.

  6. 6

    Pour warm mushroom mixture and remaining olive oil over hummus. Drizzle with extra oil and finish with a pinch of salt.

  7. 7

    Serve immediately with pita bread, vegetables, or olives.

Tools you’ll need

  • food processor
  • shallow serving bowl (8–10 inch diameter)
  • 12-inch skillet
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.